PPIRE09633
Target Protein Information
| Protein_Name | Tax1-binding protein 3 |
|---|---|
| Protein_Sequence | MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
| Organism_Source | Homo sapiens |
| Functional_Classification | PDZ domain protein |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TAX1BP3 |
| UniProt_ID | O14907 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CFTRI |
|---|---|
| Peptide_Sequence | TEEEVQDTRI |
| Peptide_Length | 10 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)[C@@H](C)O)C(C)C)[C@@H](C)O)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1219.27 |
|---|---|
| Aliphatic_Index | 68.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.20000 |
| Charge_at_pH_7 | -2.99625 |
| Isoelectric_Point | 3.77824 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 19 |
| Number_of_Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 619.87000 |
| X_logP_energy | -7.17693 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Stereochemical determinants of C-terminal specificity in PDZ peptide-binding domains: a novel contribution of the carboxylate-binding loop. |
| Release_Year | 2013 |
| PMID | 23243314 |
| DOI | 10.1074/jbc.M112.401588 |