PPIRE09701
Target Protein Information
| Protein_Name | Gonadotropin-releasing hormone receptor |
|---|---|
| Protein_Sequence | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | GNRHR |
| UniProt_ID | P30968 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | DOTA-triptorelin-hydrazide |
|---|---|
| Peptide_Sequence | XHSWYwLRPG |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)NCC(=O)O |
| Chemical_Modification | X1=pyroglutamate; G10=pSCN-Bn-DOTA |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | hydrazide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1258.40 |
|---|---|
| Aliphatic_Index | 39.00000 |
| Aromaticity | 0.30000 |
| Average_Rotatable_Bonds | 3.30000 |
| Charge_at_pH_7 | 1.08804 |
| Isoelectric_Point | 9.35118 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 479.05000 |
| X_logP_energy | -1.80573 |
Interaction Information
| Affinity | IC50=0.47 nM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Preclinical evaluation of new GnRH-I receptor radionuclide therapy with 177 Lu-peptide tracer. |
| Release_Year | 2019 |
| PMID | 31033025 |
| DOI | 10.1002/jlcr.3742 |