PPIRE09709
Target Protein Information
| Protein_Name | Gonadotropin-releasing hormone receptor |
|---|---|
| Protein_Sequence | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | GNRHR |
| UniProt_ID | P30968 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | DOTA-Ahx-(D-Lys6-GnRH1) |
|---|---|
| Peptide_Sequence | XHWSYkLRPG |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)NCC(=O)O |
| Chemical_Modification | X1=pyroglutamate; k6=Ahx-DOTA |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Pyroglutamylation |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1200.37 |
|---|---|
| Aliphatic_Index | 39.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | 2.08774 |
| Isoelectric_Point | 10.45503 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 489.28000 |
| X_logP_energy | -3.40073 |
Interaction Information
| Affinity | IC50=36.1 nM |
|---|---|
| Affinity_Assay | competitive radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis and evaluation of novel gonadotropin-releasing hormone receptor-targeting peptides. |
| Release_Year | 2011 |
| PMID | 21749045 |
| DOI | 10.1021/bc200252j |