PPIRE10027
Target Protein Information
| Protein_Name | Protein BMH1 |
|---|---|
| Protein_Sequence | MSTSREDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSESGQAEDQQQQQQHQQQQPPAAAEGEAPK |
| Organism_Source | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Functional_Classification | 14-3-3 proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | BMH1 |
| UniProt_ID | P29311 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Nha1_pS479_Bmh1 |
|---|---|
| Peptide_Sequence | KAGRSFSLHRM |
| Peptide_Length | 11 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN)C(=O)O |
| Chemical_Modification | S5=phosphoserine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Fitc |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1289.52 |
|---|---|
| Aliphatic_Index | 44.54545 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 3.08859 |
| Isoelectric_Point | 12.51648 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 19 |
| Number_of_Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 573.28000 |
| X_logP_energy | -6.45456 |
Interaction Information
| Affinity | KD=64 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The activity of Saccharomyces cerevisiae Na+, K+/H+ antiporter Nha1 is negatively regulated by 14-3-3 protein binding at serine 481. |
| Release_Year | 2019 |
| PMID | 31446061 |
| DOI | 10.1016/j.bbamcr.2019.118534 |