PPIRE10059
Target Protein Information
| Protein_Name | SH2 domain-containing protein 1A |
|---|---|
| Protein_Sequence | MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP |
| Organism_Source | Homo sapiens |
| Functional_Classification | SH2 domain-containing proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SH2D1A |
| UniProt_ID | O60880 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SLAM-Y281 |
|---|---|
| Peptide_Sequence | KSLTIYAQVAK |
| Peptide_Length | 11 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Fluorescein |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1221.46 |
|---|---|
| Aliphatic_Index | 115.45455 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.72727 |
| Charge_at_pH_7 | 1.99654 |
| Isoelectric_Point | 10.24761 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 18 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 510.14000 |
| X_logP_energy | -4.12080 |
Interaction Information
| Affinity | KD=0.6 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A three-pronged binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome. |
| Release_Year | 2002 |
| PMID | 11823424 |
| DOI | 10.1093/emboj/21.3.314 |