PPIRE10086
Target Protein Information
| Protein_Name | Speckle-type POZ protein |
|---|---|
| Protein_Sequence | MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-protein ligases |
| Cellular_Localization | Nucleus |
| Gene_Names | SPOP |
| UniProt_ID | O43791 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Pdx1 SPOP-binding peptide(219-233)non-phosphorylated |
|---|---|
| Peptide_Sequence | PEQDCAVTSGE |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H]1CCCN1)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1135.17 |
|---|---|
| Aliphatic_Index | 35.45455 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.27273 |
| Charge_at_pH_7 | -3.05999 |
| Isoelectric_Point | 3.42471 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 19 |
| Number_of_Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 535.78000 |
| X_logP_energy | -8.24900 |
Interaction Information
| Affinity | KD=95.9 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 6F8F |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The Structure of the SPOP-Pdx1 Interface Reveals Insights into the Phosphorylation-Dependent Binding Regulation. |
| Release_Year | 2018 |
| PMID | 30449689 |
| DOI | 10.1016/j.str.2018.10.005 |