PPIRE10218
Target Protein Information
| Protein_Name | Dynein light chain 1, cytoplasmic |
|---|---|
| Protein_Sequence | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
| Organism_Source | Homo sapiens |
| Functional_Classification | motor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | DYNLL1 |
| UniProt_ID | P63167 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Nek9 peptide |
|---|---|
| Peptide_Sequence | VGMHSKGTQTA |
| Peptide_Length | 11 |
| Peptide_SMILES | CSCC[C@H](NC(=O)CNC(=O)[C@@H](N)C(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1116.26 |
|---|---|
| Aliphatic_Index | 35.45455 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.36364 |
| Charge_at_pH_7 | 1.08860 |
| Isoelectric_Point | 9.70200 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 19 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 512.80000 |
| X_logP_energy | -7.94770 |
Interaction Information
| Affinity | KD=0.16 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 3ZKE |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural analysis of the regulation of the DYNLL/LC8 binding to Nek9 by phosphorylation. |
| Release_Year | 2013 |
| PMID | 23482567 |
| DOI | 10.1074/jbc.M113.459149 |