PPIRE10243
Target Protein Information
| Protein_Name | Dynein light chain 1, cytoplasmic |
|---|---|
| Protein_Sequence | MSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA |
| Organism_Source | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Functional_Classification | motor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | DYN2 |
| UniProt_ID | Q02647 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Nup159 pep4 |
|---|---|
| Peptide_Sequence | YAVDNGLQTEP |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@H]1C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1206.27 |
|---|---|
| Aliphatic_Index | 70.90909 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.27273 |
| Charge_at_pH_7 | -2.00064 |
| Isoelectric_Point | 3.55007 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 18 |
| Number_of_Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 546.77000 |
| X_logP_energy | -6.08460 |
Interaction Information
| Affinity | KD=13.1 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 4DS1 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of a yeast Dyn2-Nup159 complex and molecular basis for dynein light chain-nuclear pore interaction. |
| Release_Year | 2012 |
| PMID | 22411995 |
| DOI | 10.1074/jbc.M111.336172 |