PPIRE10254
Target Protein Information
| Protein_Name | Rhodopsin |
|---|---|
| Protein_Sequence | MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA |
| Organism_Source | Bos taurus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | RHO |
| UniProt_ID | P02699 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ArrFL-2/3 |
|---|---|
| Peptide_Sequence | YGREDLDVLGL |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1249.39 |
|---|---|
| Aliphatic_Index | 132.72727 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.72727 |
| Charge_at_pH_7 | -2.00020 |
| Isoelectric_Point | 3.87601 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 17 |
| Number_of_Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 548.35000 |
| X_logP_energy | -3.67083 |
Interaction Information
| Affinity | KD=1.3 mM |
|---|---|
| Affinity_Assay | ultraviolet-visible absorption spectroscopy |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structure of a common GPCR-binding interface for G protein and arrestin. |
| Release_Year | 2014 |
| PMID | 25205354 |
| DOI | 10.1038/ncomms5801 |