PPIRE10292
Target Protein Information
| Protein_Name | Melanin-concentrating hormone receptor 1 |
|---|---|
| Protein_Sequence | MDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | MCHR1 |
| UniProt_ID | Q99705 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ac-hMCH(6-16)-NH2 |
|---|---|
| Peptide_Sequence | RCMLGRVYRPC |
| Peptide_Length | 11 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C2<->C11; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1353.68 |
|---|---|
| Aliphatic_Index | 61.81818 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.81818 |
| Charge_at_pH_7 | 2.87317 |
| Isoelectric_Point | 9.59364 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 19 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 551.46000 |
| X_logP_energy | -4.56319 |
Interaction Information
| Affinity | IC50=0.17 nM |
|---|---|
| Affinity_Assay | radioligand filter binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis and biological evaluation in vitro of a selective, high potency peptide agonist of human melanin-concentrating hormone action at human melanin-concentrating hormone receptor 1. |
| Release_Year | 2002 |
| PMID | 11839762 |
| DOI | 10.1074/jbc.M200563200 |