PPIRE10412
Target Protein Information
| Protein_Name | Circumsporozoite protein |
|---|---|
| Protein_Sequence | EALFQEYQCYGSSSNTRVLNELNYDNAGTNLYNELEMNYYGKQENWYSLKKNSRSLGENDDGNNNNGDNGREGKDEDKRDGNNEDNEKLRKPKHKKLKQPADGNPDPNANPNVDPNANPNVDPNANPNVDPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNVDPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNKNNQGNGQGHNMPNDPNRNVDENANGNNAVKNNNNEEPSDQHIEKYL |
| Organism_Source | Plasmodium falciparum (isolate le5) |
| Functional_Classification | surface proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | CSP |
| UniProt_ID | P05691 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | (NPNA)3 |
|---|---|
| Peptide_Sequence | NPNANPNANPNA |
| Peptide_Length | 12 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC(N)=O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1207.22 |
|---|---|
| Aliphatic_Index | 25.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.66667 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 19 |
| Number_of_Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 615.59000 |
| X_logP_energy | -11.43820 |
Interaction Information
| Affinity | KD=0.078 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 6AXL |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for antibody recognition of the NANP repeats in Plasmodium falciparum circumsporozoite protein. |
| Release_Year | 2017 |
| PMID | 29138320 |
| DOI | 10.1073/pnas.1715812114 |