PPIRE10587
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MAMTKKFKVSFDVTAKMSSDVQAILEKDMLHLCKQVGSGAIVPNGKQKEMIVQFLTHGMEGLMTFVVRTSFREAIKDMHEEYADKDSFKQSSATVREVF |
| Organism_Source | Escherichia phage T7 |
| Functional_Classification | DNA polymerases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | None |
| UniProt_ID | Q6WY88 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | TP-2 |
|---|---|
| Peptide_Sequence | SRNVNCNASVCTIPDRLITDNPGSGS |
| Peptide_Length | 26 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CS)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CO)C(C)C)C(C)C)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CO)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C6<->C11; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2690.94 |
|---|---|
| Aliphatic_Index | 71.15385 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.26923 |
| Charge_at_pH_7 | -0.12508 |
| Isoelectric_Point | 6.17585 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 43 |
| Number_of_Hydrogen_Bond_Donors | 45 |
| Topological_Polar_Surface_Area | 1265.38000 |
| X_logP_energy | -21.16836 |
Interaction Information
| Affinity | IC50=10 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptide ligands specific to the oxidized form of Escherichia coli thioredoxin. |
| Release_Year | 2008 |
| PMID | 18672101 |
| DOI | 10.1016/j.bbapap.2008.06.022 |