PPIRE10756
Target Protein Information
| Protein_Name | Low density lipoprotein receptor adapter protein 1 |
|---|---|
| Protein_Sequence | MDALKSAGRALIRSPSLAKQSWAGGRHRKLPENWTDTRETLLEGMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDSLTSQLIENVSIYRISYCTAQMHDKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSKEEKEKREKANQEGGDVPGTRRDSTPSLKTSVATGNLLDLEELAKAPLSTVSANTKNMDDALRPQVLGNNSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDIHYAQCLSPTDWDKPDSSGFDQDDVFSF |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | endocytic adaptor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Ldlrap1 |
| UniProt_ID | D3ZAR1 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | LDLR tail |
|---|---|
| Peptide_Sequence | SINFDNPVYQKT |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)O)[C@@H](C)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Biotin-Peg8 |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1425.56 |
|---|---|
| Aliphatic_Index | 56.66667 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | -0.00271 |
| Isoelectric_Point | 6.33059 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 627.91000 |
| X_logP_energy | -6.87650 |
Interaction Information
| Affinity | KD=4 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 3SO6 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Atomic structure of the autosomal recessive hypercholesterolemia phosphotyrosine-binding domain in complex with the LDL-receptor tail. |
| Release_Year | 2012 |
| PMID | 22509010 |
| DOI | 10.1073/pnas.1114128109 |