PPIRE10806
Target Protein Information
| Protein_Name | UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase |
|---|---|
| Protein_Sequence | MPSIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD |
| Organism_Source | Escherichia coli O157:H7 |
| Functional_Classification | acyltransferases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | lpxD |
| UniProt_ID | P65323 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | FITC-Photo1 |
|---|---|
| Peptide_Sequence | TNXYMLPKWDIP |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@H](CCSC)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)[C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | X3=photo-leucine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Fluorescein Isothiocyanate |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1434.67 |
|---|---|
| Aliphatic_Index | 65.00000 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 3.41667 |
| Charge_at_pH_7 | -0.00271 |
| Isoelectric_Point | 6.33059 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 19 |
| Number_of_Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 528.50000 |
| X_logP_energy | -2.24760 |
Interaction Information
| Affinity | KD=2.1 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for the recognition of peptide RJPXD33 by acyltransferases in lipid A biosynthesis. |
| Release_Year | 2014 |
| PMID | 24742680 |
| DOI | 10.1074/jbc.M114.564278 |