PPIRE10809
Target Protein Information
| Protein_Name | Chromobox protein homolog 3 |
|---|---|
| Protein_Sequence | MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | chromodomain-containing proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | CBX3 |
| UniProt_ID | Q13185 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Histone H1K26me2 |
|---|---|
| Peptide_Sequence | TPVKKKARKSAG |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1270.54 |
|---|---|
| Aliphatic_Index | 40.83333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.75000 |
| Charge_at_pH_7 | 4.99680 |
| Isoelectric_Point | 11.99738 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 20 |
| Number_of_Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 581.07000 |
| X_logP_energy | -7.28313 |
Interaction Information
| Affinity | KD=52 mM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 3TZD |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a. |
| Release_Year | 2012 |
| PMID | 22514736 |
| DOI | 10.1371/journal.pone.0035376 |