PPIRE10870
Target Protein Information
| Protein_Name | Ig gamma-1 chain C region secreted form |
|---|---|
| Protein_Sequence | AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulin |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg1 |
| UniProt_ID | P01868 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | AbetapE3-12 fibrils |
|---|---|
| Peptide_Sequence | XFRHDSGYEVHH |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)CN)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O |
| Chemical_Modification | X1=pyroglutamate |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Pyroglutamate |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1440.50 |
|---|---|
| Aliphatic_Index | 24.16667 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | -0.72792 |
| Isoelectric_Point | 6.79329 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 646.42000 |
| X_logP_energy | -6.66663 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and functional analyses of pyroglutamate-amyloid-Beta-specific antibodies as a basis for Alzheimer immunotherapy. |
| Release_Year | 2017 |
| PMID | 28623233 |
| DOI | 10.1074/jbc.M117.777839 |