PPIRE10976
Target Protein Information
| Protein_Name | Histone-binding protein RBBP4 |
|---|---|
| Protein_Sequence | MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS |
| Organism_Source | Homo sapiens |
| Functional_Classification | chromatin remodeling complex component |
| Cellular_Localization | Nucleus |
| Gene_Names | RBBP4 |
| UniProt_ID | Q09028 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | AEBP2_379-390 peptide |
|---|---|
| Peptide_Sequence | KRRKLKNKRRRS |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1625.99 |
|---|---|
| Aliphatic_Index | 32.50000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 5.33333 |
| Charge_at_pH_7 | 8.99679 |
| Isoelectric_Point | 13.11267 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 34 |
| Topological_Polar_Surface_Area | 860.32000 |
| X_logP_energy | -10.52275 |
Interaction Information
| Affinity | KD=7.6 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and biochemical insights into human zinc finger protein AEBP2 reveals interactions with RBBP4. |
| Release_Year | 2017 |
| PMID | 29134516 |
| DOI | 10.1007/s13238-017-0483-6 |