PPIRE11006
Target Protein Information
| Protein_Name | Small ubiquitin-related modifier 2 |
|---|---|
| Protein_Sequence | MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-like modifiers |
| Cellular_Localization | Nucleus |
| Gene_Names | SUMO2 |
| UniProt_ID | P61956 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | M-IR2 SIM |
|---|---|
| Peptide_Sequence | DNEIEVIIVWEKK |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(C)C |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1614.86 |
|---|---|
| Aliphatic_Index | 134.61538 |
| Aromaticity | 0.07692 |
| Average_Rotatable_Bonds | 4.30769 |
| Charge_at_pH_7 | -1.99683 |
| Isoelectric_Point | 4.14755 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 672.64000 |
| X_logP_energy | -2.40730 |
Interaction Information
| Affinity | KD=22 uM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | 2LAS |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Insights into high affinity small ubiquitin-like modifier (SUMO)recognition by SUMO-interacting motifs (SIMs)revealed by a combination of NMR and peptide array analysis. |
| Release_Year | 2012 |
| PMID | 22147707 |
| DOI | 10.1074/jbc.M111.293118 |