PPIRE11099
Target Protein Information
| Protein_Name | Urokinase plasminogen activator surface receptor |
|---|---|
| Protein_Sequence | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT |
| Organism_Source | Homo sapiens |
| Functional_Classification | Ly-6/uPAR protein family |
| Cellular_Localization | Plasma membrane |
| Gene_Names | PLAUR |
| UniProt_ID | Q03405 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | AE147 |
|---|---|
| Peptide_Sequence | KSDXFskYLWSSK |
| Peptide_Length | 13 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | X4=L-b-cyclohexyl-alanine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1532.72 |
|---|---|
| Aliphatic_Index | 30.00000 |
| Aromaticity | 0.23077 |
| Average_Rotatable_Bonds | 3.92308 |
| Charge_at_pH_7 | 1.99670 |
| Isoelectric_Point | 10.11959 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 24 |
| Topological_Polar_Surface_Area | 644.82000 |
| X_logP_energy | -6.36070 |
Interaction Information
| Affinity | KD=16.4 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 1YWH |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structure of the human urokinase plasminogen activator receptor bound to an antagonist peptide. |
| Release_Year | 2005 |
| PMID | 15861141 |
| DOI | 10.1038/sj.emboj.7600635 |