PPIRE11200
Target Protein Information
| Protein_Name | Gamma-aminobutyric acid receptor-associated protein |
|---|---|
| Protein_Sequence | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-like modifiers |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GABARAP |
| UniProt_ID | O95166 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | N1 peptide |
|---|---|
| Peptide_Sequence | SHKSDWIFLPNAA |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1485.66 |
|---|---|
| Aliphatic_Index | 75.38462 |
| Aromaticity | 0.15385 |
| Average_Rotatable_Bonds | 3.38462 |
| Charge_at_pH_7 | 0.08904 |
| Isoelectric_Point | 7.54935 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 20 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 595.07000 |
| X_logP_energy | -4.74970 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification of calreticulin as a ligand of GABARAP by phage display screening of a peptide library. |
| Release_Year | 2007 |
| PMID | 17916189 |
| DOI | 10.1111/j.1742-4658.2007.06073.x |