PPIRE11286
Target Protein Information
| Protein_Name | Urokinase-type plasminogen activator |
|---|---|
| Protein_Sequence | MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | PLAU |
| UniProt_ID | P00749 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | UK504(bicyclic 3) |
|---|---|
| Peptide_Sequence | CCLGRGCENHRCL |
| Peptide_Length | 13 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CS)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CS)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain cyclization; C1<->C12; disulfide bond; C2<->C7; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1463.73 |
|---|---|
| Aliphatic_Index | 60.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.69231 |
| Charge_at_pH_7 | 0.84276 |
| Isoelectric_Point | 7.93588 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 645.39000 |
| X_logP_energy | -8.47736 |
Interaction Information
| Affinity | Ki=8 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | 4GLY |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides. |
| Release_Year | 2014 |
| PMID | 25343607 |
| DOI | 10.1038/NCHEM.2043 |