PPIRE11347
Target Protein Information
| Protein_Name | Tumor necrosis factor ligand superfamily member 11 |
|---|---|
| Protein_Sequence | MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQVVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
| Organism_Source | Mus musculus |
| Functional_Classification | TNF family ligand |
| Cellular_Localization | Extracellular |
| Gene_Names | Tnfsf11 |
| UniProt_ID | O35235 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | L3-3 |
|---|---|
| Peptide_Sequence | YCWNSDCECCYRR |
| Peptide_Length | 13 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CS)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C2<->C11; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1700.90 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.23077 |
| Average_Rotatable_Bonds | 3.92308 |
| Charge_at_pH_7 | -0.24940 |
| Isoelectric_Point | 6.10124 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 26 |
| Number_of_Hydrogen_Bond_Donors | 31 |
| Topological_Polar_Surface_Area | 730.49000 |
| X_logP_energy | -7.71056 |
Interaction Information
| Affinity | KD=17.3 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL)inhibitor peptide and molecular basis for osteopetrosis. |
| Release_Year | 2010 |
| PMID | 21059944 |
| DOI | 10.1073/pnas.1011686107 |