PPIRE11429
Target Protein Information
| Protein_Name | Protein CBFA2T1 |
|---|---|
| Protein_Sequence | MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR |
| Organism_Source | Homo sapiens |
| Functional_Classification | transcriptional corepressors |
| Cellular_Localization | Nucleus |
| Gene_Names | RUNX1T1 |
| UniProt_ID | Q06455 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HEB AD1 peptide |
|---|---|
| Peptide_Sequence | FLSNTDKELSDLLD |
| Peptide_Length | 14 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)Cc1ccccc1)[C@@H](C)O)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | N-fluorescein |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Fluorescein |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1609.75 |
|---|---|
| Aliphatic_Index | 111.42857 |
| Aromaticity | 0.07143 |
| Average_Rotatable_Bonds | 3.92857 |
| Charge_at_pH_7 | -2.99920 |
| Isoelectric_Point | 3.69901 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 24 |
| Topological_Polar_Surface_Area | 720.62000 |
| X_logP_energy | -7.21350 |
Interaction Information
| Affinity | KD=12.5 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of the AML1-ETO eTAFH domain-HEB peptide complex and its contribution to AML1-ETO activity. |
| Release_Year | 2009 |
| PMID | 19204326 |
| DOI | 10.1182/blood-2008-06-161307 |