PPIRE11487
Target Protein Information
| Protein_Name | DNA excision repair protein ERCC-1 |
|---|---|
| Protein_Sequence | MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP |
| Organism_Source | Homo sapiens |
| Functional_Classification | nucleases |
| Cellular_Localization | Nucleus |
| Gene_Names | ERCC1 |
| UniProt_ID | P07992 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | XPA67-80 |
|---|---|
| Peptide_Sequence | KIIDTGGGFILEEE |
| Peptide_Length | 14 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1520.70 |
|---|---|
| Aliphatic_Index | 111.42857 |
| Aromaticity | 0.07143 |
| Average_Rotatable_Bonds | 3.78571 |
| Charge_at_pH_7 | -2.99654 |
| Isoelectric_Point | 3.77824 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 637.07000 |
| X_logP_energy | -4.39910 |
Interaction Information
| Affinity | KD=0.78 mM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 2JNW |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA. |
| Release_Year | 2007 |
| PMID | 17948053 |
| DOI | 10.1038/sj.emboj.7601894 |