PPIRE11564
Target Protein Information
| Protein_Name | Proliferating cell nuclear antigen |
|---|---|
| Protein_Sequence | MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
| Organism_Source | Homo sapiens |
| Functional_Classification | DNA sliding clamp |
| Cellular_Localization | Nucleus |
| Gene_Names | PCNA |
| UniProt_ID | P12004 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ZRANB3 APIM motif |
|---|---|
| Peptide_Sequence | SKHGSDITRFLVKK |
| Peptide_Length | 14 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CO)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C)[C@@H](C)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1615.90 |
|---|---|
| Aliphatic_Index | 76.42857 |
| Aromaticity | 0.07143 |
| Average_Rotatable_Bonds | 4.07143 |
| Charge_at_pH_7 | 3.08845 |
| Isoelectric_Point | 11.07954 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 708.25000 |
| X_logP_energy | -7.22083 |
Interaction Information
| Affinity | KD=9.24 mM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 5MLW |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural insights into the function of ZRANB3 in replication stress response. |
| Release_Year | 2017 |
| PMID | 28621305 |
| DOI | 10.1038/ncomms15847 |