PPIRE11591
Target Protein Information
| Protein_Name | SH2 domain-containing protein 1A |
|---|---|
| Protein_Sequence | MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP |
| Organism_Source | Homo sapiens |
| Functional_Classification | SH2 domain-containing adaptor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SH2D1A |
| UniProt_ID | O60880 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SLAM Y281 peptide |
|---|---|
| Peptide_Sequence | VEKKSLTIYAQVQK |
| Peptide_Length | 14 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1634.94 |
|---|---|
| Aliphatic_Index | 104.28571 |
| Aromaticity | 0.07143 |
| Average_Rotatable_Bonds | 4.14286 |
| Charge_at_pH_7 | 1.99802 |
| Isoelectric_Point | 10.11959 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 24 |
| Topological_Polar_Surface_Area | 703.85000 |
| X_logP_energy | -5.77100 |
Interaction Information
| Affinity | KD=650 nM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 1D4T |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Conserved Vdelta1 Binding Geometry in a Setting of Locus-Disparate pHLA Recognition by delta/alphabeta T Cell Receptors (TCRs): Insight into Recognition of HIV Peptides by TCRs. |
| Release_Year | 1999 |
| PMID | None |
| DOI | 10.1016/S1097-2765(00)80167-2 |