PPIRE11622
Target Protein Information
| Protein_Name | D(2)dopamine receptor |
|---|---|
| Protein_Sequence | MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Drd2 |
| UniProt_ID | P61169 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | somatostatin |
|---|---|
| Peptide_Sequence | AGCKNFFWKTFTSC |
| Peptide_Length | 14 |
| Peptide_SMILES | C[C@H](N)C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C3<->C14; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1639.91 |
|---|---|
| Aliphatic_Index | 7.14286 |
| Aromaticity | 0.28571 |
| Average_Rotatable_Bonds | 3.57143 |
| Charge_at_pH_7 | 1.87344 |
| Isoelectric_Point | 8.82168 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 24 |
| Topological_Polar_Surface_Area | 613.23000 |
| X_logP_energy | -5.44900 |
Interaction Information
| Affinity | IC50=9 uM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Somatostatin competes with the central portion of gastrin releasing peptide for binding to a 120 kDa protein. |
| Release_Year | 1978 |
| PMID | 20504692 |
| DOI | 10.1016/0197-0186(91)90184-f |