PPIRE11705
Target Protein Information
| Protein_Name | H-2 class II histocompatibility antigen, A-Q beta chain |
|---|---|
| Protein_Sequence | MALQIPSLLLSAAVVVLMVLSSPRTEGGNSERHFVAQLKGECYFTNGTQRIRSVNRYIYNREEWVRFDSDVGEYRAVTELGRPDAEYWNSQPEILERTRAEVDTVCRHNYEGVETHTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQSESARSKMLSGIGGCVLGVIFLGLGLFIRHRSQKGPRGPPPAGLLQ |
| Organism_Source | Mus musculus |
| Functional_Classification | MHC class II |
| Cellular_Localization | Plasma membrane |
| Gene_Names | H2-Ab1 |
| UniProt_ID | P06342 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HEL(11-25) |
|---|---|
| Peptide_Sequence | AMKRHGLDNYRGYSL |
| Peptide_Length | 15 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](C)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1781.02 |
|---|---|
| Aliphatic_Index | 58.66667 |
| Aromaticity | 0.13333 |
| Average_Rotatable_Bonds | 3.93333 |
| Charge_at_pH_7 | 2.08734 |
| Isoelectric_Point | 10.00670 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 26 |
| Number_of_Hydrogen_Bond_Donors | 29 |
| Topological_Polar_Surface_Area | 790.30000 |
| X_logP_energy | -7.82616 |
Interaction Information
| Affinity | KD=6 mM |
|---|---|
| Affinity_Assay | Scatchard analysis |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis of peptide binding and presentation by the type I diabetes-associated MHC class II molecule of NOD mice. |
| Release_Year | 2000 |
| PMID | 10894169 |
| DOI | 10.1016/s1074-7613(00)80220-4 |