PPIRE11794
Target Protein Information
| Protein_Name | Chromobox protein homolog 1 |
|---|---|
| Protein_Sequence | MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN |
| Organism_Source | Homo sapiens |
| Functional_Classification | reader domains |
| Cellular_Localization | Nucleus |
| Gene_Names | CBX1 |
| UniProt_ID | P83916 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3K9allyl |
|---|---|
| Peptide_Sequence | ARTKQTARXSTGGKA |
| Peptide_Length | 15 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | X9=allyllysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Tamra |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1489.65 |
|---|---|
| Aliphatic_Index | 20.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.46667 |
| Charge_at_pH_7 | 3.99739 |
| Isoelectric_Point | 12.53175 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 25 |
| Number_of_Hydrogen_Bond_Donors | 29 |
| Topological_Polar_Surface_Area | 770.57000 |
| X_logP_energy | -13.67586 |
Interaction Information
| Affinity | KD=106 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Engineering Methyllysine Writers and Readers for Allele-Specific Regulation of Protein-Protein Interactions. |
| Release_Year | 2019 |
| PMID | 31518125 |
| DOI | 10.1021/jacs.9b05725 |