PPIRE11857
Target Protein Information
| Protein_Name | Transcriptional coactivator YAP1 |
|---|---|
| Protein_Sequence | MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL |
| Organism_Source | Homo sapiens |
| Functional_Classification | transcription coactivators |
| Cellular_Localization | Nucleus |
| Gene_Names | YAP1 |
| UniProt_ID | P46937 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Smad7(203-217)peptide |
|---|---|
| Peptide_Sequence | ELESPPPPYSRYPMD |
| Peptide_Length | 15 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1777.97 |
|---|---|
| Aliphatic_Index | 26.00000 |
| Aromaticity | 0.13333 |
| Average_Rotatable_Bonds | 3.13333 |
| Charge_at_pH_7 | -1.99972 |
| Isoelectric_Point | 3.92755 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 25 |
| Number_of_Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 681.49000 |
| X_logP_energy | -5.13553 |
Interaction Information
| Affinity | KD=9.8 mM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for the versatile interactions of Smad7 with regulator WW domains in TGF-Beta Pathways. |
| Release_Year | 2012 |
| PMID | 22921829 |
| DOI | 10.1016/j.str.2012.07.014 |