PPIRE11947
Target Protein Information
| Protein_Name | TRAF-interacting protein with FHA domain-containing protein A |
|---|---|
| Protein_Sequence | MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQFILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES |
| Organism_Source | Homo sapiens |
| Functional_Classification | adaptor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TIFA |
| UniProt_ID | Q96CG3 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pThr9-TIFA1-15 |
|---|---|
| Peptide_Sequence | MTSFEDADXEETVTC |
| Peptide_Length | 15 |
| Peptide_SMILES | CSCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)O)C(C)C)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | X9=phosphothreonine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1634.70 |
|---|---|
| Aliphatic_Index | 26.00000 |
| Aromaticity | 0.06667 |
| Average_Rotatable_Bonds | 3.53333 |
| Charge_at_pH_7 | -5.05777 |
| Isoelectric_Point | 3.22577 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 27 |
| Number_of_Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 738.14000 |
| X_logP_energy | -9.90310 |
Interaction Information
| Affinity | KD=319 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 4YM4 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Uncovering the Mechanism of Forkhead-Associated Domain-Mediated TIFA Oligomerization That Plays a Central Role in Immune Responses. |
| Release_Year | 2015 |
| PMID | 26389808 |
| DOI | 10.1021/acs.biochem.5b00500 |