PPIRE11958
Target Protein Information
| Protein_Name | Circumsporozoite protein |
|---|---|
| Protein_Sequence | EALFQEYQCYGSSSNTRVLNELNYDNAGTNLYNELEMNYYGKQENWYSLKKNSRSLGENDDGNNNNGDNGREGKDEDKRDGNNEDNEKLRKPKHKKLKQPADGNPDPNANPNVDPNANPNVDPNANPNVDPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNVDPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNKNNQGNGQGHNMPNDPNRNVDENANGNNAVKNNNNEEPSDQHIEKYL |
| Organism_Source | Plasmodium falciparum (isolate le5) |
| Functional_Classification | Circumsporozoite protein |
| Cellular_Localization | Extracellular |
| Gene_Names | CSP |
| UniProt_ID | P05691 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide 21 |
|---|---|
| Peptide_Sequence | NPDPNANPNVDPNAN |
| Peptide_Length | 15 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC(N)=O)C(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1562.57 |
|---|---|
| Aliphatic_Index | 32.66667 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.80000 |
| Charge_at_pH_7 | -2.00112 |
| Isoelectric_Point | 3.49188 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 768.70000 |
| X_logP_energy | -12.89210 |
Interaction Information
| Affinity | KD=7.5 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 6B5M |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A human monoclonal antibody prevents malaria infection by targeting a new site of vulnerability on the parasite. |
| Release_Year | 2018 |
| PMID | 29554083 |
| DOI | 10.1038/nm.4512 |