PPIRE12028
Target Protein Information
| Protein_Name | Growth factor receptor-bound protein 2 |
|---|---|
| Protein_Sequence | MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV |
| Organism_Source | Mus musculus |
| Functional_Classification | SH3 domains |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Grb2 |
| UniProt_ID | Q60631 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Sos-A |
|---|---|
| Peptide_Sequence | SPLLPKLPPKTYKRE |
| Peptide_Length | 15 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1767.14 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.06667 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | 2.99802 |
| Isoelectric_Point | 10.63646 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 673.51000 |
| X_logP_energy | -3.81493 |
Interaction Information
| Affinity | KD=54 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Orientation of peptide fragments from Sos proteins bound to the N-terminal SH3 domain of Grb2 determined by NMR spectroscopy. |
| Release_Year | 1994 |
| PMID | 7947763 |
| DOI | 10.1021/bi00250a004 |