PPIRE12064
Target Protein Information
| Protein_Name | HLA class II histocompatibility antigen, DRB1 beta chain |
|---|---|
| Protein_Sequence | MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class II |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLA-DRB1 |
| UniProt_ID | P01911 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Cit26 |
|---|---|
| Peptide_Sequence | TSKGLFXAAVPSGAS |
| Peptide_Length | 15 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](N)[C@@H](C)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)O)C(C)C |
| Chemical_Modification | X6=Citrulline |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1349.51 |
|---|---|
| Aliphatic_Index | 65.33333 |
| Aromaticity | 0.06667 |
| Average_Rotatable_Bonds | 2.73333 |
| Charge_at_pH_7 | 0.99769 |
| Isoelectric_Point | 9.70000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 568.87000 |
| X_logP_energy | -8.92290 |
Interaction Information
| Affinity | IC50=0.5 uM |
|---|---|
| Affinity_Assay | competitive radioligand binding assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Functional and Structural Characterization of a Novel HLA-DRB1*04:01-Restricted Alpha-Enolase T Cell Epitope in Rheumatoid Arthritis. |
| Release_Year | 2016 |
| PMID | 27895642 |
| DOI | 10.3389/fimmu.2016.00494 |