PPIRE12092
Target Protein Information
| Protein_Name | C3a anaphylatoxin chemotactic receptor |
|---|---|
| Protein_Sequence | MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | C3AR1 |
| UniProt_ID | Q16581 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | S4 |
|---|---|
| Peptide_Sequence | WWTRRWRASKLGLAR |
| Peptide_Length | 15 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1943.29 |
|---|---|
| Aliphatic_Index | 65.33333 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 4.06667 |
| Charge_at_pH_7 | 4.99768 |
| Isoelectric_Point | 12.98095 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 34 |
| Topological_Polar_Surface_Area | 832.17000 |
| X_logP_energy | -5.32392 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | De novo peptide design with C3a receptor agonist and antagonist activities: theoretical predictions and experimental validation. |
| Release_Year | 2012 |
| PMID | 22500977 |
| DOI | 10.1021/jm201609k |