PPIRE12118
Target Protein Information
| Protein_Name | Interleukin-17A |
|---|---|
| Protein_Sequence | MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Organism_Source | Homo sapiens |
| Functional_Classification | interleukins |
| Cellular_Localization | Extracellular |
| Gene_Names | IL17A |
| UniProt_ID | Q16552 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 18-903 |
|---|---|
| Peptide_Sequence | CFDLQYDPWGALHCI |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CS)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | Side chain-side chain cyclization; C1<->C14; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1781.03 |
|---|---|
| Aliphatic_Index | 84.66667 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.40000 |
| Charge_at_pH_7 | -2.03501 |
| Isoelectric_Point | 4.10652 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 644.32000 |
| X_logP_energy | -2.56340 |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Utilization of peptide phage display to investigate hotspots on IL-17A and what it means for drug discovery. |
| Release_Year | 2018 |
| PMID | 29329326 |
| DOI | 10.1371/journal.pone.0190850 |