PPIRE12129
Target Protein Information
| Protein_Name | Interleukin-17A |
|---|---|
| Protein_Sequence | MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Organism_Source | Homo sapiens |
| Functional_Classification | interleukins |
| Cellular_Localization | Extracellular |
| Gene_Names | IL17A |
| UniProt_ID | Q16552 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 18-902 |
|---|---|
| Peptide_Sequence | CWVLEYDMFGALHCR |
| Peptide_Length | 15 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CS)C(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C1<->C14; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1843.17 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.73333 |
| Charge_at_pH_7 | -1.03369 |
| Isoelectric_Point | 5.44933 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 671.92000 |
| X_logP_energy | -2.31873 |
Interaction Information
| Affinity | KD=1.3 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 5VB9 |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Utilization of peptide phage display to investigate hotspots on IL-17A and what it means for drug discovery. |
| Release_Year | 2018 |
| PMID | 29329326 |
| DOI | 10.1371/journal.pone.0190850 |