PPIRE12157
Target Protein Information
| Protein_Name | Streptavidin |
|---|---|
| Protein_Sequence | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Organism_Source | Streptomyces avidinii |
| Functional_Classification | avidin family |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P22629 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | cyclo-[5-S-valeramide-HPQGPPC]K-NH2 |
|---|---|
| Peptide_Sequence | XHPQGPPCK |
| Peptide_Length | 9 |
| Peptide_SMILES | NCCCC[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1c[nH]cn1)NC(=O)CN)C(=O)O |
| Chemical_Modification | X1=5-S-valeramide |
| Cyclization_Method | Side chain-side chain cyclization; X1<->C8; other bonds |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | 5-S-Valeramide |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 920.05 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.66667 |
| Charge_at_pH_7 | 1.02662 |
| Isoelectric_Point | 8.55276 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 14 |
| Number_of_Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 367.54000 |
| X_logP_energy | -4.65180 |
Interaction Information
| Affinity | KD=256 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0. |
| Release_Year | 1997 |
| PMID | 9148939 |
| DOI | 10.1074/jbc.272.20.13220 |