PPIRE12163
Target Protein Information
| Protein_Name | Streptavidin |
|---|---|
| Protein_Sequence | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Organism_Source | Streptomyces avidinii |
| Functional_Classification | avidin family |
| Cellular_Localization | Extracellular |
| Gene_Names | |
| UniProt_ID | P22629 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | cyclo-Ac-AE[CHPQFC]IEGRK-NH2 |
|---|---|
| Peptide_Sequence | AECHPQFCIEGRK |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)N)C(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | Side chain-side chain cyclization; C3<->C9; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1517.74 |
|---|---|
| Aliphatic_Index | 37.69231 |
| Aromaticity | 0.07692 |
| Average_Rotatable_Bonds | 3.76923 |
| Charge_at_pH_7 | -0.03180 |
| Isoelectric_Point | 7.25494 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 22 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 638.02000 |
| X_logP_energy | -6.12503 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0. |
| Release_Year | 1997 |
| PMID | 9148939 |
| DOI | 10.1074/jbc.272.20.13220 |