PPIRE12186
Target Protein Information
| Protein_Name | Chromobox protein homolog 1 |
|---|---|
| Protein_Sequence | MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN |
| Organism_Source | Homo sapiens |
| Functional_Classification | chromodomain-containing proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | CBX1 |
| UniProt_ID | P83916 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3K27me3 |
|---|---|
| Peptide_Sequence | QLATKAARXSAPATG |
| Peptide_Length | 15 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](N)CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)NCC(=O)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | X9=trimethyllysine |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Fluorescein |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1399.57 |
|---|---|
| Aliphatic_Index | 59.33333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.93333 |
| Charge_at_pH_7 | 1.99769 |
| Isoelectric_Point | 11.65178 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 22 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 653.63000 |
| X_logP_energy | -10.48823 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Recognition and specificity determinants of the human cbx chromodomains. |
| Release_Year | 2011 |
| PMID | 21047797 |
| DOI | 10.1074/jbc.M110.191411 |