PPIRE12222
Target Protein Information
| Protein_Name | Zinc finger CW-type PWWP domain protein 2 |
|---|---|
| Protein_Sequence | MDKEKLDVKIEYCNYAMDSSVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDFPEESQLHQCGFKIVYSQLPLGSLVLVKLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIEFLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLLYGYSHEQRLEMCCLSKLQDKSETHDKVAALVKKRKQTSKNNIEKKKPKFRKRKRKAILKCSFENVYSDDALSKENRVVCETEVLLKELEQMLQQALQPTATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF |
| Organism_Source | Homo sapiens |
| Functional_Classification | histone modification reader |
| Cellular_Localization | Nucleus |
| Gene_Names | ZCWPW2 |
| UniProt_ID | Q504Y3 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3R2me2aK4me3 |
|---|---|
| Peptide_Sequence | ARTKQTARKSTGGKAP |
| Peptide_Length | 16 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | R2=asymmetric dimethylarginine; K4=trimethyllysine |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1657.89 |
|---|---|
| Aliphatic_Index | 18.75000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.56250 |
| Charge_at_pH_7 | 4.99709 |
| Isoelectric_Point | 12.54608 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 27 |
| Number_of_Hydrogen_Bond_Donors | 30 |
| Topological_Polar_Surface_Area | 816.90000 |
| X_logP_energy | -13.18726 |
Interaction Information
| Affinity | KD=13.3 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 4O62 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Family-wide Characterization of Histone Binding Abilities of Human CW Domain-containing Proteins. |
| Release_Year | 2016 |
| PMID | 26933034 |
| DOI | 10.1074/jbc.M116.718973 |