PPIRE12346
Target Protein Information
| Protein_Name | Neuropeptide Y receptor type 1 |
|---|---|
| Protein_Sequence | MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | NPY1R |
| UniProt_ID | P25929 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | INP-K[e-J-(a-DO3A-e-DGa)-K]YRLRY-NH2 |
|---|---|
| Peptide_Sequence | INPKXXaDXKYRLRY |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | X5=DO3A-e-DGa; J5=4-aminophenylalanine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1765.00 |
|---|---|
| Aliphatic_Index | 55.00000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 3.62500 |
| Charge_at_pH_7 | 2.99613 |
| Isoelectric_Point | 10.44817 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 25 |
| Number_of_Hydrogen_Bond_Donors | 28 |
| Topological_Polar_Surface_Area | 787.72000 |
| X_logP_energy | -8.15456 |
Interaction Information
| Affinity | IC50=80 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | In Vitro Mouse and Human Serum Stability of a Heterobivalent Dual-Target Probe That Has Strong Affinity to Gastrin-Releasing Peptide and Neuropeptide Y1 Receptors on Tumor Cells. |
| Release_Year | 2017 |
| PMID | 28186846 |
| DOI | 10.1089/cbr.2016.2136 |