PPIRE12350
Target Protein Information
| Protein_Name | Mitogen-activated protein kinase 14 |
|---|---|
| Protein_Sequence | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
| Organism_Source | Homo sapiens |
| Functional_Classification | MAP kinase |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAPK14 |
| UniProt_ID | Q16539 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide 4 |
|---|---|
| Peptide_Sequence | IPTSPITTTYFFFKKK |
| Peptide_Length | 16 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1919.29 |
|---|---|
| Aliphatic_Index | 48.75000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 3.62500 |
| Charge_at_pH_7 | 2.99625 |
| Isoelectric_Point | 10.64292 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 26 |
| Number_of_Hydrogen_Bond_Donors | 24 |
| Topological_Polar_Surface_Area | 681.68000 |
| X_logP_energy | -3.64620 |
Interaction Information
| Affinity | Km=49 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Kinetic mechanism of the p38-alpha MAP kinase: phosphoryl transfer to synthetic peptides. |
| Release_Year | 2000 |
| PMID | 10684658 |
| DOI | 10.1021/bi9919495 |