PPIRE12448
Target Protein Information
| Protein_Name | Uncharacterized protein encoded by SND1-IT1 |
|---|---|
| Protein_Sequence | MSHHPHSLRNSCLIRMDLLYWQFTIYTITFCFSHLSGRLTLSAQHISHRPCLLSYSLLFWKVHHLFLEGFPCSPRLDEMSFHQFPQHPVHVSVVHLPIVYKGSMTQVSPH |
| Organism_Source | Homo sapiens |
| Functional_Classification | Tudor domain-containing proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SND1-IT1 |
| UniProt_ID | Q9HBX3 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PIWIL1 R4me2a peptide |
|---|---|
| Peptide_Sequence | TGRARARARGRARGQE |
| Peptide_Length | 16 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H](N)[C@@H](C)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | R3=asymmetrical dimethylarginine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1768.96 |
|---|---|
| Aliphatic_Index | 25.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.87500 |
| Charge_at_pH_7 | 4.99974 |
| Isoelectric_Point | 12.80105 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 26 |
| Number_of_Hydrogen_Bond_Donors | 38 |
| Topological_Polar_Surface_Area | 971.84000 |
| X_logP_energy | -15.26518 |
Interaction Information
| Affinity | KD=40 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for recognition of arginine methylated Piwi proteins by the extended Tudor domain. |
| Release_Year | 2010 |
| PMID | 20937909 |
| DOI | 10.1073/pnas.1013106107 |