PPIRE12491
Target Protein Information
| Protein_Name | Interleukin-17A |
|---|---|
| Protein_Sequence | MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Organism_Source | Homo sapiens |
| Functional_Classification | interleukins |
| Cellular_Localization | Extracellular |
| Gene_Names | IL17A |
| UniProt_ID | Q16552 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 585-869 |
|---|---|
| Peptide_Sequence | DISAVCWAFPFDPECH |
| Peptide_Length | 16 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C6<->C15; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1837.05 |
|---|---|
| Aliphatic_Index | 55.00000 |
| Aromaticity | 0.18750 |
| Average_Rotatable_Bonds | 3.12500 |
| Charge_at_pH_7 | -3.03239 |
| Isoelectric_Point | 3.87492 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 658.84000 |
| X_logP_energy | -3.73410 |
Interaction Information
| Affinity | KD=0.25 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Utilization of peptide phage display to investigate hotspots on IL-17A and what it means for drug discovery. |
| Release_Year | 2018 |
| PMID | 29329326 |
| DOI | 10.1371/journal.pone.0190850 |