PPIRE12547
Target Protein Information
| Protein_Name | Microtubule-associated protein 1 light chain 3 beta |
|---|---|
| Protein_Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
| Organism_Source | Homo sapiens |
| Functional_Classification | autophagy-related proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAP1LC3B |
| UniProt_ID | Q9GZQ8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | KBTBD7 AIM peptide |
|---|---|
| Peptide_Sequence | SSSFSDDEVWVQVAPQ |
| Peptide_Length | 16 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CO)C(C)C)C(C)C)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1780.87 |
|---|---|
| Aliphatic_Index | 60.62500 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 3.37500 |
| Charge_at_pH_7 | -2.99935 |
| Isoelectric_Point | 3.38003 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 26 |
| Number_of_Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 785.82000 |
| X_logP_energy | -9.55450 |
Interaction Information
| Affinity | KD=2.3 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | CUL3-KBTBD6/KBTBD7 ubiquitin ligase cooperates with GABARAP proteins to spatially restrict TIAM1-RAC1 signaling. |
| Release_Year | 2015 |
| PMID | 25684205 |
| DOI | 10.1016/j.molcel.2014.12.040 |