PPIRE12675
Target Protein Information
| Protein_Name | Troponin C, skeletal muscle |
|---|---|
| Protein_Sequence | MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | EF-hand proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TNNC2 |
| UniProt_ID | P02585 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | sTnI115-131 |
|---|---|
| Peptide_Sequence | RMSADAMLKALLGSKHK |
| Peptide_Length | 17 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCSC)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1857.26 |
|---|---|
| Aliphatic_Index | 86.47059 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.94118 |
| Charge_at_pH_7 | 3.08845 |
| Isoelectric_Point | 11.07954 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 28 |
| Number_of_Hydrogen_Bond_Donors | 28 |
| Topological_Polar_Surface_Area | 775.32000 |
| X_logP_energy | -7.43393 |
Interaction Information
| Affinity | KD=300 uM |
|---|---|
| Affinity_Assay | 1H NMR spectroscopy |
| PDB_ID | None |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Energetics of the induced structural change in a Ca2+ regulatory protein: Ca2+ and troponin I peptide binding to the E41A mutant of the N-domain of skeletal troponin C. |
| Release_Year | 2000 |
| PMID | 11027154 |
| DOI | 10.1021/bi001240u |