PPIRE12760
Target Protein Information
| Protein_Name | Urokinase-type plasminogen activator |
|---|---|
| Protein_Sequence | MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | PLAU |
| UniProt_ID | P00749 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | UK203 |
|---|---|
| Peptide_Sequence | ACSRYEVDCRGRXSACG |
| Peptide_Length | 17 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)[C@H](C)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)NCC(=O)O |
| Chemical_Modification | X13=d-aminobutyric acid |
| Cyclization_Method | Multi-point cyclization; C2<->C9; C2<->C16; C9<->C16; other bonds |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1789.98 |
|---|---|
| Aliphatic_Index | 28.82353 |
| Aromaticity | 0.05882 |
| Average_Rotatable_Bonds | 3.41176 |
| Charge_at_pH_7 | 0.81342 |
| Isoelectric_Point | 8.04182 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 29 |
| Number_of_Hydrogen_Bond_Donors | 35 |
| Topological_Polar_Surface_Area | 849.91000 |
| X_logP_energy | -13.40329 |
Interaction Information
| Affinity | Ki=0.064 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | 4JK6 |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Improving binding affinity and stability of peptide ligands by substituting glycines with D-amino acids. |
| Release_Year | 2013 |
| PMID | 23828687 |
| DOI | 10.1002/cbic.201300228 |