PPIRE12765
Target Protein Information
| Protein_Name | Somatostatin receptor type 2 |
|---|---|
| Protein_Sequence | MELTSEQFNGSQVWIPSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGAEDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Sstr2 |
| UniProt_ID | P30680 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HYNIC-TOC2 |
|---|---|
| Peptide_Sequence | EfCYwKTCXfCYwKTCX |
| Peptide_Length | 17 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CCC(=O)O)[C@@H](C)O)C(=O)N[C@@H](CS)C(=O)NCC(=O)O |
| Chemical_Modification | X9=Thr(ol); X17=Thr(ol) |
| Cyclization_Method | Side chain cyclization; C2<->C7; disulfide bond; C11<->C16; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Hynic |
| C-terminal_Modification | threoninol |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2125.48 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.35294 |
| Average_Rotatable_Bonds | 3.64706 |
| Charge_at_pH_7 | 0.74957 |
| Isoelectric_Point | 7.90856 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 29 |
| Number_of_Hydrogen_Bond_Donors | 31 |
| Topological_Polar_Surface_Area | 730.76000 |
| X_logP_energy | -3.14850 |
Interaction Information
| Affinity | IC50=0.74 nM |
|---|---|
| Affinity_Assay | competitive radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | (99m)Tc-labeled dimeric octreotide peptide: a radiotracer with high tumor uptake for single-photon emission computed tomography imaging of somatostatin receptor subtype 2-positive tumors. |
| Release_Year | 2013 |
| PMID | 23768172 |
| DOI | 10.1021/mp400040z |