PPIRE12786
Target Protein Information
| Protein_Name | Chromatin remodeling protein SHL |
|---|---|
| Protein_Sequence | MPKQKAPRKQLKSYKLKHINKSIQEGDAVLMRSSEPGKPSYVARVEAIETDARGSHAKVRVRWYYRPEESIGGRRQFHGAKEVFLSDHFDFQSADTIEGKCKVHSFSSYTKLDSVGNDDFFCRFEYNSTTGAFDPDRVTVFCKCEMPYNPDDLMVQCEECSEWFHPSCIGTTIEEAKKPDNFYCEECSPQQQNLHNSNSTSNNRDAKVNGKRSLEVTKSKNKHTKRPG |
| Organism_Source | Arabidopsis thaliana |
| Functional_Classification | histone methyl-lysine reader |
| Cellular_Localization | Nucleus |
| Gene_Names | SHL |
| UniProt_ID | Q9FEN9 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3(20-36)K27me2 |
|---|---|
| Peptide_Sequence | LATKAARKSAPATGGVK |
| Peptide_Length | 17 |
| Peptide_SMILES | CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)NCC(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | K8=dimethyllysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1626.92 |
|---|---|
| Aliphatic_Index | 69.41176 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.17647 |
| Charge_at_pH_7 | 3.99710 |
| Isoelectric_Point | 11.92451 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 25 |
| Number_of_Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 720.78000 |
| X_logP_energy | -9.87013 |
Interaction Information
| Affinity | KD=30.8 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Dual recognition of H3K4me3 and H3K27me3 by a plant histone reader SHL. |
| Release_Year | 2018 |
| PMID | 29930355 |
| DOI | 10.1038/s41467-018-04836-y |